<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2231 2231-30715 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, L74V, M184V, T215F K219Q K101E, Y181C, G190S   V60I, A98S, I135V, D218E, L228H, V245I  
>2231-30715| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLEKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIILP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, V82A, L90M L10FI T12TP, I13V, Q18H, K20I, R41K, K55R, D60E, L63P, A71I, I93L, C95F  
>2231-30715| codons 4-99
TLWQRPIVPVKIGGHLIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFMRVRQYEQIP
IEICGHKIIGTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006