<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2100 2100-30613 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46I, I54L, V82VAIT, I84V Q58E L10I, T12K, I15V, G16A, L19I, K20R, M36I, N37A, G51A, L63C, I66F, A71V, T91S  
>2100-30613| codons 4-99
TLWQRPIVKIKVAGQIREALLDTGADDTILEEIALPGRWKPKIIGGIAGFLKVREYDQIC
IEFCGHKVIGTVLVGPTPTNVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, T215Y D67G, K219E     E44ED, S68G, V118VI, K122E, I178M, T200A, D218E, L228LH  
>2100-30613| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKGGTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006