<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1437 1437-30731 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y     V179VD K103R, Q207E, R211K, P243T, V245T  
>1437-30731| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQTITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M Q58QE, G73C L10I, I15V, K20R, M36I, R41K, D60E, I62V, L63P, H69HR, I72L  
>1437-30731| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVREYEQVP
IEICGRKALCTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006