<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2275 2275-30725 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, N88S L10F, L33F I13V, L19V, K20T, R57K, L63P, A71T, V77I  
>2275-30725| codons 4-99
TLWQRPFVTVKIGGQVTEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFIKVKQYDQIP
IEICGHKTIGTVLIGPTPVNVIGRSLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y V75T, K219E K103N, Y181C   K49R, K122E, D123N, I135V, S162C, E169D, P170L, L228H  
>2275-30725| codons 38-247
CTELEKEGKISRIGPENPYNTPVFAIKKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDLFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006