<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2050 2050-30625 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215F K219Q Y188L A98G V60I, K102KM, K122E, S162ST, D177E, I202V, Q207K, H208Y, R211S, F214L, H221Y  
>2050-30625| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKMKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQTSMTKILEPFRKQNPEIVIYQYMDDLLVGSDLEIGQHRTKVEELRKYLLSWGLFTP
DQKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M N88D L10I, I15V, L19V, E35D, M36I, N37S, L63P, I85V, Q92K  
>2050-30625| codons 4-99
TLWQRPIVTIKVGGQVKEALLDTGADDTILEDISLPGRWKPKIVGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIVGRDLMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006