<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1134 1134-30326 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, I84V, L90M L10F, L33F, L89V I13V, I15V, K20T, M36I, N37S, R41K, L63P, A71V, G73D, I93L  
>1134-30326| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADDTIFEEISLPGKWKPKIVGGIGGFMKVRQYDQIP
IEICGHKVIDTVLVGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y V75L     K43E, S68G, K102Q, V118I, K122E, T200TI, H208HY, R211RK  
>1134-30326| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKLLDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006