<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1129 1129-30311 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215CY K219N     T39E, E44D, V118I, K122E, I135T, I142V, S162C, E169D, V179I, V189VI, T200A, I202V, H208HY, R211K, V245E  
>1129-30311| codons 38-247
CEELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPDIIIYQYMDDLYIGSDLEIGQHRAKVEELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L10F, L24I, Q58E I15V, K20M, E35D, M36MIV, R57K, I62V, L63P, I64V, A71AV, T74K, T91TA  
>1129-30311| codons 4-99
TLWQRPFVTIKVGGQLMEALIDTGADDTVLEDVNLPGRWKPKLIGGIGGFVKVKEYDQVP
VEICGHKVIGKVLVGPTPANVIGRNLLAQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006