<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1841 1841-30728 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, T215F   Y181C, G190S   K43E, K101Q, K122E, K166R, T200A, E203D, Q207A, H208Y, R211K, H221Y  
>1841-30728| codons 40-247
EMEEEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTRILEPFRKQNPDIVICQYMDDLYVSSDLEIGQHRAKIDELRAYLLKWGFFTPDK
KYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, E35D, M36I, N37E, R41K, I62IV, L63P, K70R, V77I  
>1841-30728| codons 4-99
TLWQRPVVTIKIGGQLKEALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVRQYDQVP
IEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006