<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2160 2160-30702 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C A98AG E44D, K82R, K122E, I135V, T139V, S162C, E203K, H208Y, R211K, K223Q  
>2160-30702| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNRRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNEVPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIKELRQYLWKWGFYTP
DNKHQQEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L10F, V11I, G73S I15V, K20T, E34T, E35D, N37T, I62V, L63P, A71V, I85V  
>2160-30702| codons 4-99
TLWQRPFITIKVGGQLTEALLDTGADDTVLTDMTLPGRWKPKMIGGIGGFVKVRQYDQVP
IEICGHKVISTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006