<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2077 2077-30609 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82T, L90M V11I L10R, I13V, K20I, L33V, K55R, I62V, L63P, A71L, I72L, Q92R  
>2077-30609| codons 4-99
TLWQRPRITVKIGGQLIEALLDTGADDTIVEEMNLPGRWKPKIVGGIGGFMRVRQYDQVP
IEICGHKLLGTVLVGPTPTNIIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219KR K103N, Y188L   K43Q, E44D, S48T, V60I, A98S, V118I, K122E, I135MT, E138A, G196E, R211N, E224ED  
>2077-30609| codons 38-247
CTELEQDGKITKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIEQHRTKIEELRQHLWNWGFYTP
DRKHQKDPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006