<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1424 1424-30401 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K70KPQT K103H, Y181C, G190A A98G, K101H E40F, K43Q, I135T, R172K, D177E, G196GE, H208Y, R211K, H221Y  
>1424-30401| codons 38-247
CTFLEQEGKISKIGPENPYNTPVFAIKKKNSTTWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLHKHKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPEIVICQYMDDLYVASDLEIEQHRTKIEELRQYLWKWGFYTP
DKKYQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54LV, V82A, L90M L10F, F53L, Q58E I15V, D60E, L63P, A71V  
>1424-30401| codons 4-99
TLWQRPFVTIKVGGQLKEALLDTGADDTILEEMNLPGRWKPKIVGGIGGLVKVREYEQIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006