<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1421 1421-30331 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M A62AV, V75VI, F116Y, K219E K103N, Y181C   S68G, D123E, S162C, K166Q, R172K, I178L, E204Q, Q207A, R211K, F214L, L228H  
>1421-30331| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKRKDGTRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQCSMTQILEPFKKQNPDLVICQYMDDLYVGSDLEIGQHRTKIEQLRAHLLKWGLTTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, I54L, L90M V32V_W, N88D L10R, I15V, L19Q, K20T, R41K, K55KR, L63P, K70R, A71V, V77I  
>1421-30331| codons 4-99
TLWQRPRVTIKVGGQQTEALLDTGADNTVLEEMNLPGKWKPKLIGGIGGFLRVRQYDQIP
IEICGHRVIGTVLIGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006