<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1428 1428-30313 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R T215I, K219E Y181V   K65KE, T69N, K122E, S162A, Q207E, R211K, L228HR, P243S, V245E  
>1428-30313| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKEKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIVQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFITP
DEKHQKEPPFRWMGYELHPDKWTVQSIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, I13V, K20I, M36I, Q61N, L63A, I64L, I93L  
>1428-30313| codons 4-99
TLWQRPIVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYDNIA
LEICGHKAIGTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006