<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2254 2254-30710 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, L90M L10F, G73T K20I, M36V, I62V, L63P, I66L, A71V, I72T  
>2254-30710| codons 4-99
TLWQRPFVTIKIGGQLIEALLDTGADDTILEEVNLPGRWKPKIVGGIGGFLKVRQYDQVP
IELCGHKVTTTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74LI, M184V D67G, T215I, K219Q K103S, G190A K238T K64H, T69N, V118I, K122E, I135T, G196E, Q197K, T200A, F214L, L228H, V245K  
>2254-30710| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIHKKGSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKSKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVASDLEIEKHRAKIEELRQHLLRWGLITP
DQKHQKEPPFHWMGYELHPDTWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006