<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1927 1927-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, M184V F77FL, F116Y, K219Q K103N, Y188YH   V60I, K122E, I135T, E138A, S162C, Q197E, F214L  
>1927-30527| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDLRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYYSVPLDEDFRKYTAFTIPSTNNATPGIRYQYNVLPMGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLHVGSDLEIGEHRTKIEELRQHLLRWGLTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M G73C L10I, I15V, L19V, K20R, M36I, L63P, I64V, I66V, I85IV  
>1927-30527| codons 4-99
TLWQRPIVTIKVGGQVREALLDTGADDTVLEEINLPGRWKPKIVGGIGGFMKVRQYDQIP
VEVCGHKAICTVLVGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006