<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1926 1926-30519 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73C L10IV, K20I, I62IV, L63P, I64V, I72IT, I93L  
>1926-30519| codons 4-99
TLWQRPVVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQVP
VEICGHKATCTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, L74V, M184V, L210W, T215Y D67G, K219R Y181C A98G, V108I S68G, K101Q, K122E, D123DE, E203K, R211D, K223Q, L228H  
>1926-30519| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGGDKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLQKKKSVTILDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIKELRQHLWDWGFYTP
DRKHQQEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006