<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2137 2137-40728 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32IL, M46I, I47V, I54M, V82L, L90M L33F, G73A L10I, I13V, K55KR, I62IV, L63P, I66F, V77I I85L
>2137-40728| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTLFEEMNLPGRWKPKIVGGIGGFMRVRQYD
QVPIEFCGHKAIATVLIGPTPLNILGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, M184V, T215Y K219E K103N V108I, Y318F S68G, K102Q, V118I, K122E, T200A, Q207E, R211K, L228H, V245K, I293V, M357T, R358K, G359GS, V365I, T386I, E399G  
>2137-40728| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDEKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKSA
HTNDIKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWGA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006