<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2137 2137-30723 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, L90M L33F, G73A L10I, I13V, N37NS, I62V, L63P, I66F, V77I  
>2137-30723| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTIFEEMSLPGRWKPKIVGGIGGFMKVRQYDQVP
IEFCGHKAIATVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219E K103N V108I T39TA, S68G, K102Q, V118I, K122E, I135IT, I178IM, T200A, Q207E, R211K, L228H, V245K  
>2137-30723| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006