<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2002 2002-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215F K219Q K103N, Y181C   T69N, A98S, K122P, D177E, H208Y, D218E, L228H  
>2002-30610| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKVVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A L10F, L33F, K43T K20R, E35D, M36L, L63P, A71V  
>2002-30610| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTIFEDLNLPGRWTPKIVGGIGGFMKVRQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006