<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1877 1877-30602 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54IM, V82VA, L90M V11VI, L33F, F53FL, G73S L10I, I13V, I15IV, E34EQ, N37C, R41K, I62IV, L63P, A71AV, V77I, I93L, C95CF  
>1877-30602| codons 4-99
TLWQRPIITVKVGGQLKEALLDTGADDTIFQEMCLPGKWKPKIVGGIGGLMKVRQYDQVP
IEICGHKVISTVLIGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69T_ST, L210W, T215Y A62V, V75I     K64R, V118VI, K122E, D123E, I135V, D177E, G196E, R211K, V245M  
>1877-30602| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIRKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006