<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1623 1623-30320 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V, T215F A62V, T69G, K219E   A98G D67X, I135R, S162C, Q174QK, V179I, G196E, T200A, H208HY, V245E  
>1623-30320| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKXSGRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKKNPDIIIYQYVDDLYVGSDLEIEQHRAKIEELRQYLLRWGFFTP
DEKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A, L90M G73S, L89V L10I, T12K, I13V, G16E, L19I, K20I, M36I, L38F, I62V, L63H, A71V, T74S, I93L E34E_KQY*K
>1623-30320| codons 4-99
TLWQRPIVKVKIEGQIIEALLDTGADDTVLEEINFPGRWKPKMIGGIGGFAKVRQYDQVH
IEICGHKVISSVLVGPTPANIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006