<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1359 1359-30729 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210LW T215TS, K219KN L100LI, K103KN   T39TA, K43KE, V60I, R83RK, W88WC, I135IV, E138A, I202IV, R211K, V245EK  
>1359-30729| codons 38-247
CAEMEEEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFCEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLWKWGFSTP
DNKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84IV, L90LM   L10LI, T12TA, I13IV, K14KR, K20KI, E35D, M36MI, L63LP, I64V, A71AV, I72IV, P79PH, I93IL  
>1359-30729| codons 4-99
TLWQRPIVAVRIGGQLIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYDQIP
VEICGHKVVGTVLVGHTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006