<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2168 2168-30804 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM N88D R41K, K45R, L63P, V77VI, I93L  
>2168-30804| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGKWKPRMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V, T215TNSY   K103N   E53D, K122E, I135V, S162C, I178M, Q197K, V245E  
>2168-30804| codons 38-247
CTEMEKEGKISKIGPDNPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGKHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006