<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1281 1281-30424 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N   T39A, V60I, T69TN, K122E, I135M, E138Q, Q174K, N175Y, G196E, R211K, V245VE L120L*W, V189VL, K201IV
>1281-30424| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPWDEDFRKYTAFTIPSMNNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKKYPDIVIYQYMDDLYLGSDLEIEQHRTVIEELRQHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S L10I, K20V, L24LM, D60E, Q61E, I62IV, L63P, H69Q, A71V, I72R, V77IM D25N
>1281-30424| codons 4-99
TLWQRPIVTIKIGGQLVEALMNTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYEEVP
IEICGQKVRSTVLMGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006