<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2184 2184-30807 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I   T12N, L63P, V77I, Q92E, I93L  
>2184-30807| codons 4-99
TLWQRPLVNIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLIGPTPVNIIGRNLLTELGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N P225H I135IT, S162A, V179VI, I244V  
>2184-30807| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEHPFLWMGYELHPDKWTVQPVVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006