<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2183 2183-30701 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V, L90M L10F, L33F, G73T I13V, L19I, L24LM, L63P, A71AV  
>2183-30701| codons 4-99
TLWQRPFVTVKIGGQIKEALMDTGADDTVFEEMNLPGRWKPKIIGGIGGFMKVRQYDQIP
IEICGHKVITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, T215Y A62V K103KN, Y181C   I135T, K166R, L228H  
>2183-30701| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006