<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1345 1345-30501 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82AT, L90M   K20R, E35D, M36I, N37D, R41K, R57K, I62V, L63P, A71V, I85V  
>1345-30501| codons 4-99
TLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVKQYDQVP
IEICGHKVIGTVLVGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219Q K103N, Y181C, G190A A98G T39A, E40F, V106VI, K122E, D123N, G196E, E203K, Q207E, H208Y, K223E, L228H K65K_N
>1345-30501| codons 38-247
CAFLEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSITVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIEQHRTKIKELREYLWRWGFYTP
DQKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006