<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2177 2177-30627 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10FI, G73C I15IV, R41K, I62IV, L63P, I72K  
>2177-30627| codons 4-99
TLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYDQVP
IEICGHKAKCTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, L210W, T215Y D67G K103N, Y181C   K122KE, K173QR, V245I  
>2177-30627| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIILP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006