<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1809 1809-30429 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84IV L10F, L24I, L33LF, K43T M36MI, N37S, R41K, K55R, I62IV, L63P, I64V, A71AT, T91S  
>1809-30429| codons 4-99
TLWQRPFVTIKIGGQLKEALIDTGADDTVFEEISLPGKWTPKIIGGIGGFVRVRQYDQVP
VEICGHKTIGTVLVGPTPANVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MIV V75A, K219Q     V90VI, V118VI, K122E, D123E, S162Y, G196GR, T200A, E203K, Q207E, D218DE, V245E K64*Y, K73IM
>1809-30429| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIYKKNSTRWRMLADFRELNKRTQDFWEIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIRQHRAKIKELREHLLRWGFTTP
EQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006