<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1979 1979-30514 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54A, V82A, L90LM L10FV, K43T I13V, I15V, K20T, E35D, M36I, R41K, I62V, L63P, I64V, A71V, T74S, V77I, I93L  
>1979-30514| codons 4-99
TLWQRPVVTVKVGGQLTEALLDTGADDTVLEDINLPGKWTPKIIGGIGGFAKVRQYDQVP
VEICGHKVIGSVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39S, R83RK, A98S, K122P, I142V, Q174QR, D177E, G196E, Q207E, R211K, L228R, D237E  
>1979-30514| codons 38-247
CSELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEIVIYQYVDDLYVGSDLEIEQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFRWMGYELHPEKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006