<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1970 1970-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M L10F, G73A I15V, L19V, K20I, E34Q, E35D, M36I, N37S, R57K, Q61H, L63P, I64V, I85IV, Q92K  
>1970-30604| codons 4-99
TLWQRPFVTIKVGGQVIEALLDTGADDTVLQDISLPGRWKPKIVGGIGGFMKVKQYDHIP
VEICGHKAIATVLVGPTPVNVVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C, G190A   T39K, K43E, E44D, K101Q, K102Q, V118I, K122E, S134SG, I135T, S162C, E169D, E203D, H208Y, R211K, D218E  
>1970-30604| codons 38-247
CKELEEDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPGTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIDELRQYLWKWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006