<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2038 2038-30709 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50V, I54V, V82A, L90M L10FV, V11VI, K43T, G73S, L89V K14R, I15V, G16A, K20I, M36I, Q61QH, I62IV, L63P, A71V, I72IM, I85V L19LHQ
>2038-30709| codons 4-99
TLWQRPVITIRVAGQQIEALLDTGADDTVLEEINLPGRWTPKIIGGVGGFVKVRQYDHVP
IEICGHKVMSTVLVGPTPANIVGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184I, L210W, T215Y D67G, K70T, K219N Y181C, G190S K101N T39A, E40F, K43KE, S68G, V118I, K122E, I135T, R211K, L228H, V245T  
>2038-30709| codons 38-247
CAFLEEEGKISKIGPENPYNTPVFAIKKKGGTTWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLNKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYIDDLYVSSDLEIGQHRTKIEELRQHLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006