<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2031 2031-30728 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y K219E K101E, Y181C   T39A, E44D, V60I, I94L, I135T, T139R, Q174QR, G196E, I202IV, E203K, L228H  
>2031-30728| codons 38-247
CAELEKDGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHP
AGLEKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVICQYVDDLYVGSDLEIEQHRTKVKELRQHLWRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I54V, L90M N88D I13V, E35D, M36I, N37E, I62V, L63P, A71T  
>2031-30728| codons 4-99
TLWQRPLVTVKIGGQLKEALLDTGADNTVLEDIELPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKTIGTVLVGPTPVNIIGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006