<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2029 2029-30724 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IL, I84V, L90M G73T L10I, I15V, K20I, E35D, L63P, A71V, I85V, I93L  
>2029-30724| codons 4-99
TLWQRPIVTIKVGGQLIEALLDTGADDTVLEDMNLPGRWKPKIIGGIGGFLKVRQYDQIP
IEICGHKVITTVLVGPTPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67NS, K70R, T215F K219Q Y181C, G190A   T39N, K46Q, T69N, K101A, K103R, K122E, I135V, K166R, Q207DN, D218E, L228H, P243PH, V245E  
>2029-30724| codons 38-247
CNEMEKEGQISKIGPENPYNTPVFAIKKKSSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLAKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRNHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQHIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006