<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1321 1321-30402 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   Y188L   T39TA, K43E, E44D, S68G, K82R, V118I, K122E, I135T, T139K, S162A, R172K, R211K, K223T, E224D E53EK
>1321-30402| codons 38-247
CAELEEDGKISKIGPKNPYNTPVFAIKKKDGTKWRKVVDFRELNRRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFKKQNPDIVIYQYMDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQTDPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, I84V, L90M L10F, Q58E, G73S, L89V V11L, T12S, I13V, K14R, I15V, Q18H, L19Q, K20I, E34Q, M36MI, N37S, G51A, D60E, L63P, A71V, P79Q  
>1321-30402| codons 4-99
TLWQRPFLSVRVGGHQIEALLDTGADDTVLQEISLPGRWKPKMIGGIAGFMKVREYEQIP
IEICGHKVISTVLVGQTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006