<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1976 1976-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y   L100I, K103N   K43N, D123E, Q174R, E203K, Q207D, R211RK, L228H  
>1976-30604| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSDKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIGQHRTKIKELRDHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M G73T L10I, K20R, E35D, M36I, N37E, R57K, I62IV, L63P, C67F, H69R, A71V, P79AS, I85V, I93L, C95V  
>1976-30604| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKIVGGIGGFMKVKQYDQVP
IEIFGRKVITTVLVGSTPVNVVGRNLMTQLGVTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006