<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1900 1900-30527 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LIV, M184V, L210W, T215Y K219N K103N A98G V118I, K122E, T200A, H208HY, R211Q D186DY
>1900-30527| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDYLYVGSDLEIGQHRAKIEELRQYLWQWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M G73S L10I, I15V, K20R, E35D, M36I, R57K, D60E, I62V, L63P, A71V, I72IL  
>1900-30527| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYEQVP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006