<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1676 1676-30331 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184MV, L210W, T215Y K219N Y181C, G190A   E44D, V118I, K122E, I135T, V179I, T200A, D218E, V245K  
>1676-30331| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVASDLEIGQHRAKIEELRQHLWRWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54LV, I84V, L90M L33F, Q58E, G73S L10I, I13V, Q18E, K20R, E35D, M36I, K55KR, L63P, I66IL, A71V, I93L  
>1676-30331| codons 4-99
TLWQRPIVTVKIGGELREALLDTGADDTVFEDINLPGRWKPKMIGGIGGFVRVREYDQIP
IELCGHKVISTVLVGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006