<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1670 1670-30319 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IMV, V82A, I84IV, L90M F53FL L10I, N37D, R41K, I62IV, L63AP, I64IM, A71LV, I72V, T74S, I93L  
>1670-30319| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGLVKVRQYDQVP
MEICGHKVVGSVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y A62V, V75I, K219N K103N, Y181C, G190A   E44D, V118I, K122E, I135T, I142V, D177E, G196E, H208Y, R211K, L228H, Q242L  
>1670-30319| codons 38-247
CTELEKDGKISKIGPENPYNTPVFVIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLEIEQHRTKIEELRQYLWKWGFYTP
DNKHQKEPPFHWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006