<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2395 2395-30807 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, L76V, I84V, L90M L10F I15V, K20I, E34K, E35D, M36I, R57K, Q61H, L63P, A71V, I72L, I85V  
>2395-30807| codons 4-99
TLWQRPFVTIKVGGQLIEALLDTGADDTVLKDINLPGRWKPKIIGGIGGFMKVKQYDHIP
IEICGHKVLGTVVVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, T69D, Q151M, T215Y D67T, K219KE L100I, K103N   E79D, K102KR, K122E, R172K, I178IM, T200A, E203D, Q207A, R211A, H221Y, L228LR V111L, N137NI
>2395-30807| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKRKTSDKWRKLVDFRDLNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDLGDAYFSVPLDEDFRKYTAFTIPSINIETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFKKQNPDMVIYQYMDDLYVGSDLEIGQHRAKIDELRAHLLAWGFYTP
DEKYQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006