<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1007 1007-30519 U.S. 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82A, L90M L33F, K43KT L10I, I15V, L19T, K20R, E35D, M36I, R41K, Q61E, I62IV, L63P, H69K, T74S, L89M, I93L  
>1007-30519| codons 4-99
TLWQRPIVTIKVGGQTREALLDTGADDTVFEDINLPGKWTPKLIGGIGGFVKVRQYDEVP
IEICGKKAIGSVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y     F227L T39S, E44D, V111I, V118I, K122E, D123N, K173A, Q174K, D177E, I178L, T200A, E203K, Q207E, H208Y, R211K, K223E, V245Q  
>1007-30519| codons 38-247
CSELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDIGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPELVIYQYVDDLYVGSDLEIGQHRAKIKELREYLWKWGFYTP
DKKHQEEPPLLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006