<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1001 1001-30227 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GASW, I54T, V82A L33F L10I, V11L, G16A, L19V, K20R, E34Q, E35D, M36I, N37E, D60E, L63P, I64IL, A71V, V77I, L89I, I93L  
>1001-30227| codons 4-99
TLWQRPILTIKIAGQVREALLDTGADDTVFQDIELPGRWKPKMIWGIGGFTKVRQYEQIP
LEICGHKVIGTVLIGPTPANIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69DE, L74LV, L210W, T215Y D67G, K219KR     E44D, V60I, S68SG, V118I, K122E, D123DE, S162A, D177E, I178M, T200S, Q207E, R211K  
>1001-30227| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKGGEKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRSKIEELREHLWKWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006