<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2415 2415-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82VF, L90M F53L, G73T L10I, L19I, K43R, I62V, L63P, I66IL, A71AV, V77I, I93L  
>2415-30821| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWRPKIIGGIGGLVKVRQYDQVP
IELCGHKVITTVLIGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L210W, T215Y K219Q Y188L   E44D, V118VI, K122E, R172K, D177E, I178M, T200TA, E203K, Q207E, R211K, K223Q, L228H  
>2415-30821| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPEMVIYQYMDDLLVGSDLEIGQHRAKIKELREHLWKWGFYTP
DQKHQQEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006