<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4083 4083-30311 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67DN T215TN G190S K238KT R83K, D121Y, K122E, S162A, I178L, V179I, R211T  
>4083-30311| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDLIIYQYMDDLYVSSDLEIGQHRTKIEELRQHLLTWGFNTP
DKKHQKEPPFLWMGYELHPDTWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37ND, L63P  
>4083-30311| codons 4-99
TLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006