<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4077 4077-30318 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, L90M M46V L10V, K14R, R41K, D60E, L63P  
>4077-30318| codons 4-99
TLWQRPVVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKVIVGIGGFIKVRQYEQIP
IEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N   T39A, E44D, A98S, V118I, K122E, I135T, Q197E, T200R, Q207K, R211D I63K
>4077-30318| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAKKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGEHRRKIEELRKHLWDWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006