<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4070 4070-30226 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54ILM, L76V, I84V L10FI, L24LI, L89LV I13V, K20T, E34K, M36MI, L63P, A71V, I72L, V77I  
>4070-30226| codons 4-99
TLWQRPIVTVKIGGQLTEALIDTGADDTVLKEINLPGRWKPKIIGGIGGFMKVRQYDQIP
IEICGHKVLGTVVIGPTPVNVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y V75VL K101P, V106VA, G190A   E44D, V118VI, K122E, V179VI, T200TA, Q207E, H208Y, R211K, D237DN  
>4070-30226| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVLDFRELNKRTQDFWEVQLGIPHP
AGLPKKKSATVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVASDLEIGQHRAKIEELREYLWKWGFYTP
DKKHQKEPPFLWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006