<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BAA161443 BAA161443 Singapore 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   K103KN V108VI I5IV, E6D, T7TS, V8I, K11KT, V35T, T39K, K43E, K122E, D123N, K173V, Q174K, D177E, I178M, V179I, Q207A, R211S, K238KR, V245E, E291D, V292I, I293V, K311R, E312N, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R  
>BAA161443| codons 1-399
PISPVDSIPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILRNPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, I62IV, L63LFPS, H69K, L89M T74TI
>BAA161443| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGKKAIGIVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005