<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BAA161433 BAA161433 Singapore 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 13
2 3TC+AZT+IDV 170
3 NVP+RTV+SQV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, L90M L33F, N83D L10I, I13V, E35D, M36I, R41K, L63T, H69K, L89IM  
>BAA161433| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEDINLPGKWKPKMIVGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVDIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C A98AG E6N, K11T, V35T, T39K, K43E, K101KQ, D121H, K122E, D123S, K173I, Q174K, D177E, I202V, Q207A, R211S, H221HY, V245E, K277R, T286A, A288T, E291D, V292I, I293V, E312T, I329V, G335D, R356K, M357K, G359S, K366R, A371V, K390R, K395R  
>BAA161433| codons 1-399
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYMDDLYVGSDLEIGQHRTKVEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKTLTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWE

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005