<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BAA157679 BAA157679 Singapore 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 231

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y N348IT     E6D, V21I, V35T, T39K, K43E, V60I, V106VI, V118VI, K122E, D123N, K173I, Q174K, D177E, I178M, G196E, Q207A, R211S, V245K, A272P, T286A, E291D, V292I, I293V, E312T, I326V, I329V, G335D, M357K, G359S, K366R, A371V, K390R, E399D  
>BAA157679| codons 1-399
PISPIDTVPVKLKPGMDGPKIKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIEQHRTKIEELRAHLWSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQDQWTYQIYQEPFKTLKTGKYARKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90M   K14R, K20I, E35D, M36I, R41K, L63P, H69K, A71V, L89M, I93L  
>BAA157679| codons 1-99
PQITLWQRPLVTIRIGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKKVIGTVLVGPTPVNIIGRNMMTQLGCTLNF

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005