<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BAA157675 BAA157675 Singapore 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 83
2 3TC+ABC+AZT 130
3 EFV+IDV+RTV 4

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FI K219E K103N   E6D, K11T, V35T, T39K, K43E, K64KR, T69N, K122E, D123S, K173IT, Q174K, D177E, V179I, G196E, T200I, Q207A, R211S, D237E, K238R, V245E, T286A, A288T, E291D, V292I, I293V, K311R, E312T, S322SL, I326V, G335D, M357K, G359S, A371V, I375V, A376T  
>BAA157675| codons 1-399
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIRKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIII
YQYVDDLYVGSDLEIEQHRIKIEELRAHLLSWGFITPDEKHQKEPPFLWMGYELHPERWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKTLTDIVPLTEEAE
LELAENREILRTPVHGVYYDPLKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYARKRSA
HTNDVKQLTEVVQKVTTESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, L63P, H69K, L89M  
>BAA157675| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hsu, LY Characterization of mutations in CRF01_AE virus isolates from antiretroviral treatment naive and experienced patients in Singapore. JAIDS, 2005